PDB entry 2wg4

View 2wg4 on RCSB PDB site
Description: Crystal structure of the complex between human hedgehog-interacting protein HIP and sonic hedgehog without calcium
Class: signaling protein
Keywords: autocatalytic cleavage, protease, membrane, secreted, palmitate, hydrolase, signal transduction, developmental protein, signaling protein, lipoprotein, development, glycoprotein, cell membrane, disulfide bond, egf-like domain, hedgehog signaling
Deposited on 2009-04-15, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sonic hedgehog protein n-product
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wg4a_
  • Chain 'B':
    Compound: hedgehog-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wg4A (A:)
    ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
    tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
    gmlarlaveagfdwvyyeskahihcsvkaensvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wg4A (A:)
    ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdadrlmtqrck
    dklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrskygmlar
    laveagfdwvyyeskahihcsvkae
    

  • Chain 'B':
    No sequence available.