PDB entry 2wfr

View 2wfr on RCSB PDB site
Description: crystal structure of the n-terminal signalling domain of human dhh with calcium
Class: signaling protein
Keywords: lipoprotein, development, cell membrane, autocatalytic cleavage, signaling protein, disease mutation, hedgehog signalling, protease, membrane, secreted, palmitate, hydrolase, signal transduction, developmental protein
Deposited on 2009-04-14, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.18196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desert hedgehog protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43323 (0-155)
    • PDB 2WFR (156-164)
    Domains in SCOPe 2.08: d2wfra1, d2wfra2
  • Heterogens: ZN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wfrA (A:)
    qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
    mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
    ygllarlaveagfdwvyyesrnhvhvsvkadnslavklehhhhhh