PDB entry 2wfm

View 2wfm on RCSB PDB site
Description: crystal structure of polyneuridine aldehyde esterase mutant (h244a)
Class: hydrolase
Keywords: alkaloid metabolism, monoterpenoid indole alkaloids, pnae, hydrolase, serine esterase
Deposited on 2009-04-08, released 2010-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19827
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyneuridine aldehyde esterase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SE93
      • engineered mutation (243)
    Domains in SCOPe 2.06: d2wfma_
  • Chain 'B':
    Compound: polyneuridine aldehyde esterase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SE93
      • engineered mutation (243)
    Domains in SCOPe 2.06: d2wfmb_
  • Chain 'C':
    Compound: polyneuridine aldehyde esterase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SE93
      • engineered mutation (243)
    Domains in SCOPe 2.06: d2wfmc_
  • Chain 'D':
    Compound: polyneuridine aldehyde esterase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SE93
      • engineered mutation (243)
    Domains in SCOPe 2.06: d2wfmd_
  • Chain 'E':
    Compound: polyneuridine aldehyde esterase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SE93
      • engineered mutation (243)
    Domains in SCOPe 2.06: d2wfme_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wfmA (A:)
    mhsaanakqqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeiht
    frdyseplmevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhs
    ltypfekynekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakm
    ltrpgslffqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeik
    eadamgmlsqprevckclldisds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wfmA (A:)
    qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
    mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
    nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
    fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
    sqprevckclldisd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wfmB (B:)
    mhsaanakqqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeiht
    frdyseplmevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhs
    ltypfekynekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakm
    ltrpgslffqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeik
    eadamgmlsqprevckclldisds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wfmB (B:)
    qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
    mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
    nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
    fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
    sqprevckclldisd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wfmC (C:)
    mhsaanakqqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeiht
    frdyseplmevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhs
    ltypfekynekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakm
    ltrpgslffqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeik
    eadamgmlsqprevckclldisds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wfmC (C:)
    qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
    mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
    nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
    fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
    sqprevckclldisd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wfmD (D:)
    mhsaanakqqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeiht
    frdyseplmevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhs
    ltypfekynekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakm
    ltrpgslffqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeik
    eadamgmlsqprevckclldisds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wfmD (D:)
    qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
    mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
    nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
    fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
    sqprevckclldisd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wfmE (E:)
    mhsaanakqqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeiht
    frdyseplmevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhs
    ltypfekynekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakm
    ltrpgslffqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeik
    eadamgmlsqprevckclldisds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wfmE (E:)
    qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
    mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
    nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
    fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
    sqprevckclldisd