PDB entry 2wfb

View 2wfb on RCSB PDB site
Description: high resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas
Class: biosynthetic protein
Keywords: mixed molybdenum-copper sulphide cluster, alpha and beta protein, biosynthetic protein
Deposited on 2009-04-03, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18585
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative uncharacterized protein orp
  Species: Desulfovibrio gigas [TaxId:879]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5DUA6 (3-119)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2wfba1, d2wfba2
• Heterogens: PO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wfbA (A:)
  ashmqriavtaegpgldglvdprfgraagfvvvdaatmaaeyvdngasqtlshgaginaa
  qvlaksgagvlltgyvgpkafqalqaagikvgqdlegltvrqavqrfldgqvpmaagpnk