PDB entry 2wfa

View 2wfa on RCSB PDB site
Description: Structure of Beta-Phosphoglucomutase inhibited with Beryllium trifluoride, in an open conformation.
Class: isomerase
Keywords: isomerase, phosphotransferase, transition state analogue, haloacid dehalogenase superfamily
Deposited on 2009-04-03, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-220)
      • conflict (124)
      • conflict (205)
    Domains in SCOPe 2.08: d2wfaa_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wfaA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk