PDB entry 2wf4

View 2wf4 on RCSB PDB site
Description: human bace-1 in complex with 6-ethyl-1-methyl-n-((1s)-2-oxo-1-(phenylmethyl)-3-(tetrahydro-2h-pyran-4-ylamino)propyl)-1,3,4,6-tetrahydro(1,2)thiazepino(5,4,3-cd)indole-8-carboxamide 2,2-dioxide
Class: hydrolase
Keywords: hydrolase, memapsin-2, polymorphism, glycoprotein, asp-2, bace-1, zymogen, protease, membrane, transmembrane, beta-secretase, disulfide bond, aspartyl protease, alternative splicing, beta-site app cleaving enzyme
Deposited on 2009-04-02, released 2009-05-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817
      • engineered mutation (92)
      • engineered mutation (111)
      • engineered mutation (293)
    Domains in SCOPe 2.03: d2wf4a_
  • Heterogens: ZY4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wf4A (A:)
    vemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlsst
    yrdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegil
    glayaeiarpddslepffdslvkqthvpnlfslqlcgagfplqqsevlasvggsmiiggi
    dhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkk
    vfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfrit
    ilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsac
    hvhdefrtaavegpfvtldmedcgynipqtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wf4A (A:)
    emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
    rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
    layaeiarpddslepffdslvkqthvpnlfslqlcsvggsmiiggidhslytgslwytpi
    rrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaass
    tekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfritilpqqylrpvedva
    tsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegp
    fvtldmedcgyni