PDB entry 2wey

View 2wey on RCSB PDB site
Description: Human PDE-papaverine complex obtained by ligand soaking of cross- linked protein crystals
Class: hydrolase
Keywords: metal-binding, cross-linking, phosphoprotein, phosphodiesterase, allosteric enzyme, cgmp, camp, zinc, hydrolase, cytoplasm, magnesium, papaverine, polymorphism, cgmp-binding, camp-binding, nucleotide-binding, alternative splicing
Deposited on 2009-04-02, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WEY (0-1)
    • Uniprot Q9Y233 (2-End)
    Domains in SCOPe 2.07: d2weya1, d2weya2
  • Chain 'B':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WEY (0-1)
    • Uniprot Q9Y233 (2-End)
    Domains in SCOPe 2.07: d2weyb1, d2weyb2
  • Heterogens: EV1, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2weyA (A:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >2weyA (A:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2weyB (B:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >2weyB (B:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirgee