PDB entry 2we6

View 2we6 on RCSB PDB site
Description: crystal structure of plasmodium falciparum ubiquitin carboxyl-terminal hydrolase 3 (uchl3)
Class: hydrolase
Keywords: cystein proteinase, deneddylating enzyme, ubiquitin isopeptidase, deubiquitinating enzyme, hydrolase, peptidase_c12, uch-l superfamily
Deposited on 2009-03-27, released 2009-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase l3
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WE6
    Domains in SCOPe 2.07: d2we6a_
  • Chain 'B':
    Compound: ubiquitin carboxyl-terminal hydrolase l3
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WE6
    Domains in SCOPe 2.07: d2we6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2we6A (A:)
    makndiwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvnd
    nivsenntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddff
    nkvnemsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldg
    rkdhptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipndnfdii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2we6A (A:)
    diwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvkenfdn
    vwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnks
    ienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydt
    gkiiqdkfiekckddlrfsalavipndn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2we6B (B:)
    makndiwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvnd
    nivsenntndkhnlkenfdnvwfikqyipnscgtiallhlygnlrnkfeldkdsvlddff
    nkvnemsaekrgqelknnksienlhhefcgqvenrddildvdthfivfvqiegkiieldg
    rkdhptvhcftngdnflydtgkiiqdkfiekckddlrfsalavipndnfdii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2we6B (B:)
    ndiwtplesnpdslylyscklgqsklkfvdiygfnndlldmipqpvqaviflypvenfdn
    vwfikqyipnscgtiallhlygnlrnkfeldkdsvlddffnkvnemsaekrgqelknnks
    ienlhhefcgqvenrddildvdthfivfvqiegkiieldgrkdhptvhcftngdnflydt
    gkiiqdkfiekckddlrfsalavipnd