PDB entry 2wdo

View 2wdo on RCSB PDB site
Description: crystal structure of the s. coelicolor acps in complex with acetyl-coa at 1.5 a
Class: transferase
Keywords: phosphopantetheine arm, fatty acid biosynthesis, lipid synthesis, transferase, polyketides
Deposited on 2009-03-25, released 2010-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.204
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WDO
    • Uniprot O86785 (20-142)
    Domains in SCOPe 2.08: d2wdoa_
  • Heterogens: MG, ACO, COA, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wdoA (A:)
    mgsshhhhhhssglvprgshmsiigvgidvaeverfgaalertpalagrlfleselllpg
    gerrgvaslaarfaakealakalgapagllwtdaevwveaggrprlrvtgtvaaraaelg
    vaswhvslshdagiasavviaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wdoA (A:)
    msiigvgidvaeverfgaalertpalagrlfleselllpggerrgvaslaarfaakeala
    kalgapagllwtdaevwveaggrprlrvtgtvaaraaelgvaswhvslshdagiasavvi
    aeg