PDB entry 2wd8

View 2wd8 on RCSB PDB site
Description: pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00071204
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase, drug discovery, oxidoreductase, trypanosomatids, pteridine reductase, methotrexate resistance
Deposited on 2009-03-20, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wd8a_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wd8b_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wd8c_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wd8d_
  • Heterogens: NAP, CL, VGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wd8A (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wd8A (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wd8B (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wd8B (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
    gglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wd8C (C:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wd8C (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wd8D (D:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wd8D (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha