PDB entry 2wd1

View 2wd1 on RCSB PDB site
Description: human c-met kinase in complex with azaindole inhibitor
Class: transferase
Keywords: human kinase, c-met, azaindole, inhibitor, transferase, kinase, nucleotide-binding, ATP-binding, tyrosine-protein kinase
Deposited on 2009-03-19, released 2009-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-291)
      • see remark 999 (217)
    Domains in SCOPe 2.06: d2wd1a_
  • Heterogens: ZZY, GBL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wd1A (A:)
    lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
    nptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkey
    ysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditv
    yllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wd1A (A:)
    lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
    itdigevsqfltegiimkdfshpnvlsllgiclrsplvvlpymkhgdlrnfirnethnpt
    vkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysv
    hnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyll
    qgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig