PDB entry 2wcy

View 2wcy on RCSB PDB site
Description: nmr solution structure of factor i-like modules of complement c7.
Deposited on 2009-03-17, released 2009-05-19
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement component c7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCY (0-3)
    • Uniprot P10643 (4-154)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wcyA (A:)
    gshmnpltqavpkcqrweklqnsrcvckmpyecgpsldvcaqderskrilpltvckmhvl
    hcqgrnytltgrdsctlpasaekacgacplwgkcdaesskcvcreaseceeegfsicvev
    ngkeqtmseceagalrcrgqsisvtsirpcaaetq