PDB entry 2wcu

View 2wcu on RCSB PDB site
Description: Crystal structure of mammalian FucU
Class: isomerase
Keywords: fucu, fucose, ribose, pyranase, mutarotase, alternative splicing, isomerase
Deposited on 2009-03-17, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fucu homolog
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wcua_
  • Chain 'B':
    Compound: protein fucu homolog
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wcub_
  • Heterogens: FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wcuA (A:)
mvalkgipkvlspellfalarmghgdeivladanfptssicqcgpveiradgldipqlle
avlrllpldtyvespaavmdlvpsdkekglqtpiwkryesllleadckktlmklerfefy
erakkafavvatgemalygniilkkgtld

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wcuB (B:)
mvalkgipkvlspellfalarmghgdeivladanfptssicqcgpveiradgldipqlle
avlrllpldtyvespaavmdlvpsdkekglqtpiwkryesllleadckktlmklerfefy
erakkafavvatgemalygniilkkgtld