PDB entry 2wcf

View 2wcf on RCSB PDB site
Description: calcium-free (apo) s100a12
Class: metal binding protein
Keywords: calcium signalling, apo, ef-hand, calcium free, s100 protein, host-parasite response, metal binding protein
Deposited on 2009-03-11, released 2009-06-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.248
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcfa_
  • Chain 'B':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcfb_
  • Chain 'C':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcfc_
  • Chain 'D':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcfd_
  • Chain 'E':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcfe_
  • Chain 'F':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WCF (Start-3)
    • Uniprot P80511 (4-End)
    Domains in SCOPe 2.02: d2wcff_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wcfA (A:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfA (A:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wcfB (B:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfB (B:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wcfC (C:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfC (C:)
    gstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifq
    gldanqdeqvdfqefislvaialkaahyht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wcfD (D:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfD (D:)
    tkleehlegivnifhqysvrkfdtlskgelkqlltkelantiknikdkavideifqglda
    nqdeqvdfqefislvaialkaahyhthk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wcfE (E:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfE (E:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhth
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wcfF (F:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcfF (F:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikavideifqgld
    anqdeqvdfqefislvaialkaahyhth