PDB entry 2wcd

View 2wcd on RCSB PDB site
Description: crystal structure of the assembled cytolysin a pore
Deposited on 2009-03-11, released 2009-05-05
The last revision was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 3.29 Å
R-factor: 0.228
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: hemolysin e, chromosomal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EMC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wcdA (A:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdA (A:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2wcdB (B:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdB (B:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2wcdC (C:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdC (C:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2wcdD (D:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdD (D:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >2wcdE (E:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdE (E:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >2wcdF (F:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdF (F:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >2wcdG (G:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdG (G:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >2wcdH (H:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdH (H:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >2wcdI (I:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdI (I:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >2wcdJ (J:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdJ (J:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >2wcdK (K:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdK (K:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >2wcdL (L:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdL (L:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >2wcdM (M:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdM (M:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >2wcdN (N:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdN (N:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >2wcdO (O:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdO (O:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >2wcdP (P:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdP (P:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >2wcdQ (Q:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdQ (Q:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >2wcdR (R:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdR (R:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >2wcdS (S:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdS (S:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >2wcdT (T:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdT (T:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >2wcdU (U:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdU (U:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >2wcdV (V:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdV (V:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >2wcdW (W:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdW (W:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >2wcdX (X:)
    mhhhhhhteivadktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqey
    sqaasvlvgdiktllmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkd
    ilikvlddgitklneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkir
    keayagaaagvvagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqank
    didaaklkltteiaaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrhgk
    ktlfevpev
    

    Sequence, based on observed residues (ATOM records):
    >2wcdX (X:)
    ktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdikt
    llmdsqdkyfeatqtvyewcgvatqllaayillfdeynekkasaqkdilikvlddgitkl
    neaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagvva
    gpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklklttei
    aaigeiktetettrfyvdyddlmlsllkeaakkmintcneyqkrh