PDB entry 2wcc

View 2wcc on RCSB PDB site
Description: phage lambda intdbd1-64 complex with p prime 2 dna
Deposited on 2009-03-11, released 2009-04-07
The last revision was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: DNA (5'-d(*dcp*dgp*dap*dgp*dtp*dcp*dap *dap*dap*dap*dtp*dc)-3')
    Species: ENTEROBACTERIA PHAGE LAMBDA, synthetic [TaxId:10710]
  • Chain '2':
    Compound: DNA (5'-d(*dgp*dap*dtp*dtp*dtp*dtp*dgp *dap*dcp*dtp*dgp*dc)-3')
    Species: ENTEROBACTERIA PHAGE LAMBDA, synthetic [TaxId:10710]
  • Chain '3':
    Compound: integrase
    Species: ENTEROBACTERIA PHAGE LAMBDA [TaxId:10710]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records:
    >2wcc3 (3:)
    mgrrrsherrdlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsghk
    hkpl