PDB entry 2wcb

View 2wcb on RCSB PDB site
Description: s100a12 complex with zinc in the absence of calcium
Class: metal binding protein
Keywords: calcium signalling, host-parasite response, metal binding protein
Deposited on 2009-03-10, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.228
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80511 (4-94)
      • expression tag (3)
    Domains in SCOPe 2.07: d2wcba1, d2wcba2
  • Chain 'B':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80511 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d2wcbb1, d2wcbb2
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wcbA (A:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcbA (A:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wcbB (B:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcbB (B:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthk