PDB entry 2wca

View 2wca on RCSB PDB site
Description: BtGH84 in complex with n-butyl pugnac
Class: hydrolase
Keywords: glycoside hydrolase, complex, hydrolase, inhibitor, glycosidase
Deposited on 2009-03-10, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-glcnacase bt_4395
    Species: Bacteroides thetaiotaomicron VPI-5482 [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcaa1, d2wcaa2, d2wcaa3
  • Heterogens: NP6, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wcaA (A:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcaA (A:)
    lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrkys
    rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrg
    vvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqel
    vavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnp
    qkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtg
    drvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvt
    npmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpn
    ghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpl
    iveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyq
    pgvktatrvikplidrtfatvvkffnqkfnahldattd