PDB entry 2wc8

View 2wc8 on RCSB PDB site
Description: s100a12 complex with zinc in the absence of calcium
Class: metal binding protein
Keywords: calcium signalling, ef-hand, calcium free, s100 protein, host-parasite response, metal binding protein
Deposited on 2009-03-10, released 2009-06-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WC8 (Start-3)
    • Uniprot P80511 (4-94)
    Domains in SCOPe 2.01: d2wc8a_
  • Chain 'B':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WC8 (Start-3)
    • Uniprot P80511 (4-94)
    Domains in SCOPe 2.01: d2wc8b_
  • Chain 'C':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WC8 (Start-3)
    • Uniprot P80511 (4-94)
    Domains in SCOPe 2.01: d2wc8c_
  • Chain 'D':
    Compound: protein s100-a12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WC8 (Start-3)
    • Uniprot P80511 (4-94)
    Domains in SCOPe 2.01: d2wc8d_
  • Heterogens: NA, ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wc8A (A:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wc8A (A:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldaqvdfqefislvaialkaahyhthke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wc8B (B:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wc8B (B:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    ldanqdeqvdfqefislvaialkaahyhthke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wc8C (C:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wc8C (C:)
    stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
    lanqdeqvdfqefislvaialkaahyhthke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wc8D (D:)
    mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
    fqgldanqdeqvdfqefislvaialkaahyhthke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wc8D (D:)
    gstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifq
    gldanqdeqvdfqefislvaialkaahyhthke