PDB entry 2wc1

View 2wc1 on RCSB PDB site
Description: three-dimensional structure of the nitrogen fixation flavodoxin (niff) from rhodobacter capsulatus at 2.2 a
Class: electron transport
Keywords: electron transport, flavoprotein
Deposited on 2009-03-06, released 2010-04-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.246
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2wc1a_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wc1A (A:)
    makiglffgsdtgttrkiakqikdmfddevmakplnvnradvadfmaydflilgtptlgd
    gqlpglsanaasesweeflpriadqdfsgktialfglgdqvtyplefvnalfflheffsd
    rganvvgrwpakgygfedslavvegeflglaldqdnqaaltperlkgwlsliaadfglvl
    pa