PDB entry 2wbx

View 2wbx on RCSB PDB site
Description: Crystal structure of mouse cadherin-23 EC1
Deposited on 2009-03-05, released 2010-04-21
The last revision was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17343
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cadherin-23
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBX (0-0)
    • Uniprot Q99PF4 (1-101)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wbxA (A:)
mqvnrlpfftnhffdtyllisedtpvgssvtqllardmdndplvfgvsgeeasrffavep
dtgvvwlrqpldretkseftvefsvsdhqgvitrkvniqvgd