PDB entry 2wbu

View 2wbu on RCSB PDB site
Description: crystal structure of the zinc finger domain of klf4 bound to its target DNA
Class: transcription/DNA
Keywords: transcription-DNA complex, nucleus, activator, DNA-binding, zinc-finger, transcription, metal-binding, transcription regulation
Deposited on 2009-03-05, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: krueppel-like factor 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBU
    • Uniprot Q60793 (Start-89)
    Domains in SCOPe 2.08: d2wbua_
  • Chain 'B':
    Compound: 5'-d(*dgp*dap*dgp*dgp*dcp*dgp*dtp* dgp*dgp*dc)-3'
  • Chain 'C':
    Compound: 5'-d(*dgp*dcp*dcp*dap*dcp*dgp*dcp* dcp*dtp*dc)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wbuA (A:)
    gsrtathtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrk
    htghrpfqcqkcdrafsrsdhlalhmkrhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbuA (A:)
    thtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkhtghr
    pfqcqkcdrafsrsdhlalhmkrhf
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.