PDB entry 2wbs

View 2wbs on RCSB PDB site
Description: crystal structure of the zinc finger domain of klf4 bound to its target DNA
Class: transcription/DNA
Keywords: transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator, zinc-finger, transcription regulation
Deposited on 2009-03-03, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: krueppel-like factor 4
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wbsa_
  • Chain 'F':
    Compound: 5'-d(*gp*ap*gp*gp*cp*gp*cp)-3'
    Species: Mus musculus, synthetic [TaxId:10090]
  • Chain 'G':
    Compound: 5'-d(*gp*cp*gp*cp*cp*tp*cp)-3'
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2wbsA (A:)
krtathtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkh
tghrpfqcqkcdrafsrsdhlalhmkrhf

    Sequence, based on observed residues (ATOM records): (download) 
    >2wbsA (A:)
tathtcdyagcgktytksshlkahlrthtgekpyhcdwdgcgwkfarsdeltrhyrkhtg
hrpfqcqkcdrafsrsdhlalhmkrhf

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.