PDB entry 2wbr

View 2wbr on RCSB PDB site
Description: the rrm domain in gw182 proteins contributes to mirna-mediated gene silencing
Deposited on 2009-03-03, released 2009-03-24
The last revision was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gw182
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBR (0-3)
    • Uniprot Q8SY33 (4-88)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wbrA (A:)
    gamawgsswlllknltaqidgptlrtlcmqhgplvsfhpylnqgialckyttreeankaq
    malnncvlanttifaespsenevqsimqh