PDB entry 2wbf

View 2wbf on RCSB PDB site
Description: crystal structure analysis of sera5e from plasmodium falciparum with loop 690-700 ordered
Deposited on 2009-02-27, released 2009-03-31
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Serine-repeat antigen protein
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69193 (0-264)
      • conflict (189)
  • Heterogens: DMS, CA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >2wbfX (X:)
dnmfcnkeycnrlkdenncisnlqvedqgncdtswifaskyhletircmkgyeptkisal
yvancykgehkdrcdegsspmeflqiiedygflpaesnypynyvkvgeqcpkvedhwmnl
wdngkilhnknepnsldgkgytayeserfhdnmdafvkiiktevmnkgsviayikaenvm
gyefsgkkvknlcgddtadhavnivgygnyvnsegekksywivrnswgpywgdegyfkvd
mygpthchfnfihsvvifnvdlpmn