PDB entry 2wbc

View 2wbc on RCSB PDB site
Description: refined crystal structure (2.3 angstrom) of a winged bean chymotrypsin inhibitor and location of its second reactive site
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1997-11-26, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.187
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chymotrypsin inhibitor
  Species: Psophocarpus tetragonolobus [TaxId:3891]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10822 (0-182)
  Domains in SCOPe 2.07: d2wbca_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wbcA (A:)
  dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
  ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
  kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
  ssh