PDB entry 2wbc

View 2wbc on RCSB PDB site
Description: refined crystal structure (2.3 angstrom) of a winged bean chymotrypsin inhibitor and location of its second reactive site
Deposited on 1997-11-26, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.187
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2wbc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wbc_ (-)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
    ssh