PDB entry 2wb6

View 2wb6 on RCSB PDB site
Description: crystal structure of afv1-102, a protein from the acidianus filamentous virus 1
Deposited on 2009-02-22, released 2009-03-03
The last revision was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21619
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afv1-102
    Species: ACIDIANUS FILAMENTOUS VIRUS 1 [TaxId:235266]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WB6 (Start-28)
    • Uniprot Q70LC3 (29-End)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wb6A (A:)
msyyhhhhhhlestslykkagsenlyfqgivdknkivipmsefldsmflvieklgvhaek
kgsmiflsservkladwkqlgamcsdcyhcklplssfieivtrkakdkflvmynekevtl
vargvqtiqk

    Sequence, based on observed residues (ATOM records):
    >2wb6A (A:)
lestslykkagsenlyfqgivdknkivipmsefldsmflvieklgvhaekkgsmiflsse
rvkladwkqlgamcsdcyhcklplssfieivtrkakdkflvmynekevtlvarg