PDB entry 2wax

View 2wax on RCSB PDB site
Description: structure of the human ddx6 c-terminal domain in complex with an edc3-fdf peptide
Class: hydrolase
Keywords: dead-box protein, nucleotide-binding, p54, rck, mirna, p-bodies, helicase, decapping, RNA-binding, proto-oncogene, phosphoprotein, chromosomal rearrangement, ATP-dependent RNA helicase, hydrolase, cytoplasm, mRNA decay, ATP-binding
Deposited on 2009-02-18, released 2009-03-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19319
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2waxa_
  • Chain 'B':
    Compound: enhancer of mRNA-decapping protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2waxc_
  • Chain 'D':
    Compound: enhancer of mRNA-decapping protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CXS, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2waxA (A:)
    gpqdpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvell
    akkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfd
    fpklaetylhrigrsgrfghlglainlityddrfnlksieeqlgteikpipsnidkslyv
    aeyhsepvedekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2waxA (A:)
    gvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscfyihak
    mrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhrigrslg
    lainlityddrfnlksieeqlgteikpipsnidkslyvaey
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2waxC (C:)
    gpqdpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvell
    akkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfd
    fpklaetylhrigrsgrfghlglainlityddrfnlksieeqlgteikpipsnidkslyv
    aeyhsepvedekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2waxC (C:)
    kgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgyscfyiha
    kmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhrigsgr
    fghlglainlityddrfnlksieeqlgteikpipsnidkslyvae
    

  • Chain 'D':
    No sequence available.