PDB entry 2wav

View 2wav on RCSB PDB site
Description: the folding mechanism of bbl: plasticity of transition state structure observed within an ultrafast folding protein family
Class: transferase
Keywords: peripheral subunit binding domain family, temperature-jump fluorescence spectroscopy, ultrafast protein folding, transition state movement, transferase, acyltransferase, phi- value analysis
Deposited on 2009-02-16, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrolipoyltranssuccinase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WAV (0-1)
    • engineered mutation (18)
  • Uniprot B7M5P0 (2-46)
  Domains in SCOPe 2.08: d2wava_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wavA (A:)
  gsqnndalspairrllaewnldasaikgtgvggrltredvekhlaka