PDB entry 2war

View 2war on RCSB PDB site
Description: Hen Egg White Lysozyme E35Q chitopentaose complex
Class: hydrolase
Keywords: antimicrobial, bacteriolytic enzyme, allergen, hydrolase, glycosidase
Deposited on 2009-02-13, released 2010-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (34)
    Domains in SCOPe 2.08: d2wara_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2warA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfqsnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl