PDB entry 2waj

View 2waj on RCSB PDB site
Description: crystal structure of human jnk3 complexed with a 1-aryl-3,4-dihydroisoquinoline inhibitor
Class: transferase
Keywords: kinase, epilepsy, transferase, serine/threonine-protein kinase, ATP-binding, phosphoprotein, protein kinase, nucleotide-binding
Deposited on 2009-02-08, released 2009-03-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2waja_
  • Heterogens: SNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wajA (A:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wajA (A:)
    nqfysvevgdstftvlkryqnlkpigsggivcaaydavldrnvaikklsrpfqnqthakr
    ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherms
    yllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartsfmmtpyvvtryyr
    apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
    ddalqhpyinvwydpaeveapppqdkqlderehtieewkeliykevmn