PDB entry 2w9u

View 2w9u on RCSB PDB site
Description: Solution structure of jerdostatin mutant R24K from Trimeresurus jerdonii
Class: toxin
Keywords: venom, toxin, cell adhesion, blood coagulation
Deposited on 2009-01-29, released 2010-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short disintegrin jerdostatin
    Species: TRIMERESURUS JERDONII [TaxId:135726]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9U (0-2)
      • engineered mutation (23)
    • Uniprot Q7ZZM2 (3-45)
    Domains in SCOPe 2.08: d2w9ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w9uA (A:)
    amdcttgpccrqcklkpagttcwktsvsshyctgrscecpsypgng