PDB entry 2w9r
View 2w9r on RCSB PDB site
Description: structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps
Class: chaperone
Keywords: chaperone, adaptor protein, DNA condensation, iron, clps, clpa, cytoplasm, n-end rule, DNA-binding, iron storage, metal-binding, oxidoreductase
Deposited on
2009-01-28, released
2009-04-28
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-06-02, with a file datestamp of
2009-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ATP-dependent Clp protease adapter protein clpS
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A8Q6 (Start-105)
- PDB 2W9R (106-107)
Domains in SCOPe 2.02: d2w9ra_ - Chain 'B':
Compound: DNA protection during starvation protein
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2w9rA (A:)
mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctlekaga
Sequence, based on observed residues (ATOM records): (download)
>2w9rA (A:)
qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
icgvftaevaetkvamvnkyarenehpllctlekaga
- Chain 'B':
No sequence available.