PDB entry 2w9r

View 2w9r on RCSB PDB site
Description: structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps
Class: chaperone
Keywords: chaperone, adaptor protein, DNA condensation, iron, clps, clpa, cytoplasm, n-end rule, DNA-binding, iron storage, metal-binding, oxidoreductase
Deposited on 2009-01-28, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.228
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent Clp protease adapter protein clpS
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8Q6 (Start-105)
  • PDB 2W9R (106-107)
  Domains in SCOPe 2.08: d2w9ra_
• Chain 'B':
  Compound: DNA protection during starvation protein
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABT2 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2w9rA (A:)
  mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
  lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctlekaga
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2w9rA (A:)
  qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
  icgvftaevaetkvamvnkyarenehpllctlekaga
  

  
  
• Chain 'B':
  No sequence available.