PDB entry 2w9n

View 2w9n on RCSB PDB site
Description: crystal structure of linear di-ubiquitin
Class: cell cycle
Keywords: cell cycle, k63, ikk, nemo, lys63, linear, ubiquitin, signalling cell cycle
Deposited on 2009-01-27, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.26
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w9na1, d2w9na2
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w9nA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9nA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl