PDB entry 2w9l

View 2w9l on RCSB PDB site
Description: canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid
Class: receptor
Keywords: immunoglobulin domain, car, knob, fiber, fibre, cav-2, canine, complex, erythrocyte, sialic acid, glycoprotein, fiber head, adenovirus, fibre head, lipoprotein, fiber protein, cell junction, cell adhesion, red blood cell, coxsackievirus, phosphoprotein, membrane, secreted, receptor, palmitate, domain d1, host-virus interaction, virus-receptor complex, transmembrane, cell membrane, sialyl-lactose, tight junction, phosphorylation, hemagglutination
Deposited on 2009-01-26, released 2009-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9la_
  • Chain 'B':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lb_
  • Chain 'C':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lc_
  • Chain 'D':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9ld_
  • Chain 'E':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9le_
  • Chain 'F':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lf_
  • Chain 'G':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lg_
  • Chain 'H':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lh_
  • Chain 'I':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9li_
  • Chain 'J':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lj_
  • Chain 'K':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lk_
  • Chain 'L':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9ll_
  • Chain 'M':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lm_
  • Chain 'N':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9ln_
  • Chain 'O':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lo_
  • Chain 'P':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lp_
  • Chain 'Q':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lq_
  • Chain 'R':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9lr_
  • Chain 'S':
    Compound: fibre protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9L (0-11)
    • Uniprot Q65914 (12-196)
    Domains in SCOPe 2.08: d2w9ls_
  • Chain 'T':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lt_
  • Chain 'V':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lv_
  • Chain 'X':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lx_
  • Chain 'Y':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9ly_
  • Chain 'Z':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w9lz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w9lA (A:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lA (A:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w9lB (B:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lB (B:)
    lsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdki
    yddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w9lC (C:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lC (C:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w9lD (D:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lD (D:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2w9lE (E:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lE (E:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2w9lF (F:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lF (F:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2w9lG (G:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lG (G:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2w9lH (H:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lH (H:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2w9lI (I:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lI (I:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2w9lJ (J:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lJ (J:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2w9lK (K:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lK (K:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2w9lL (L:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lL (L:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2w9lM (M:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lM (M:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2w9lN (N:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lN (N:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2w9lO (O:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lO (O:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadvdqviilysgdkiyd
    dyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2w9lP (P:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lP (P:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2w9lQ (Q:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lQ (Q:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2w9lR (R:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lR (R:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2w9lS (S:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lS (S:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2w9lT (T:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lT (T:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2w9lV (V:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lV (V:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    v
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2w9lX (X:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lX (X:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2w9lY (Y:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lY (Y:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2w9lZ (Z:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9lZ (Z:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl