PDB entry 2w9e
View 2w9e on RCSB PDB site
Description: structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
Class: immune system
Keywords: fab, prp, prion, membrane, gpi-anchor, lipoprotein, golgi apparatus, disease mutation, immune system, glycoprotein, cell membrane
Deposited on
2009-01-23, released
2009-02-03
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-06-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: major prion protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2w9ea_ - Chain 'H':
Compound: icsm 18-anti-prp therapeutic fab heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: icsm 18-anti-prp therapeutic fab light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2w9eA (A:)
gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgss
Sequence, based on observed residues (ATOM records): (download)
>2w9eA (A:)
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresq
- Chain 'H':
No sequence available.
- Chain 'L':
No sequence available.