PDB entry 2w9e

View 2w9e on RCSB PDB site
Description: structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
Class: immune system
Keywords: fab, prp, prion, membrane, gpi-anchor, lipoprotein, golgi apparatus, disease mutation, immune system, glycoprotein, cell membrane
Deposited on 2009-01-23, released 2009-02-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2w9ea_
  • Chain 'H':
    Compound: icsm 18-anti-prp therapeutic fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9E (0-214)
  • Chain 'L':
    Compound: icsm 18-anti-prp therapeutic fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9E (0-211)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w9eA (A:)
    gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
    cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9eA (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.