PDB entry 2w9d

View 2w9d on RCSB PDB site
Description: structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.
Class: immune system
Keywords: immune system, prion, prp, fab
Deposited on 2009-01-23, released 2009-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: icsm 18-anti-prp therapeutic fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9D (0-214)
  • Chain 'L':
    Compound: icsm 18-anti-prp therapeutic fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2W9D (0-End)
    Domains in SCOPe 2.07: d2w9dl1, d2w9dl2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2w9dL (L:)
    eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyfchqwrsnpytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w9dL (L:)
    eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyfchqwrsnpytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn