PDB entry 2w96

View 2w96 on RCSB PDB site
Description: crystal structure of cdk4 in complex with a d-type cyclin
Class: cell cycle
Keywords: serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division, proto-oncogene, phosphoprotein, disease mutation, nucleotide-binding, cyclin dependent kinase, kinase, cyclin, oncology, cell cycle, drug desgn
Deposited on 2009-01-21, released 2009-03-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g1/s-specific cyclin-d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cell division protein kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11802 (44-End)
      • engineered mutation (42-43)
      • engineered mutation (168)
    • PDB 2W96
    Domains in SCOPe 2.05: d2w96b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w96B (B:)
    matsryepvaeigvgaygtvykardphsghfvalksvrvpngeeglpistvrevallrrl
    eafehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrq
    flrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmaldpvvvtlwyrap
    evllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwprdvs
    lprgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsylhkdegnpe
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w96B (B:)
    sryepvaeigvgaygtvykardphsghfvalksvrvpngeeglpistvrevallrrleaf
    ehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrqflr
    gldflhancivhrdlkpenilvtsggtvkladfglariysyqmaldpvvvtlwyrapevl
    lqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwvpemeesg
    aqlllemltfnphkrisafralqhsyl