PDB entry 2w90

View 2w90 on RCSB PDB site
Description: Geobacillus stearothermophilus 6-phosphogluconate with bound 6- phosphogluconate
Class: oxidoreductase
Keywords: 6pdh, geobacillus, dehydrogenase, phsophogluconate, oxidoreductase
Deposited on 2009-01-20, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W90 (Start-470)
    Domains in SCOPe 2.07: d2w90a1, d2w90a2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W90 (0-470)
    Domains in SCOPe 2.07: d2w90b1, d2w90b2
  • Heterogens: 6PG, TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w90A (A:)
    ghmakhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysie
    efvnalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelael
    gihfigtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpdgag
    hyvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieitadif
    tkideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkdervk
    askvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlrygdia
    mifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamrgip
    vpgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w90A (A:)
    hmakhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysiee
    fvnalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelaelg
    ihfigtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpdgagh
    yvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieitadift
    kideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkdervka
    skvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlrygdiam
    ifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamrgipv
    pgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w90B (B:)
    ghmakhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysie
    efvnalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelael
    gihfigtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpdgag
    hyvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieitadif
    tkideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkdervk
    askvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlrygdia
    mifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamrgip
    vpgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk