PDB entry 2w8h

View 2w8h on RCSB PDB site
Description: crystal structure of spin labeled wza24-345.
Deposited on 2009-01-16, released 2009-02-10
The last revision was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.212
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'B':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'C':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'D':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'E':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'F':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'G':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Chain 'H':
    Compound: putative outer membrane lipoprotein wza
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X4B7 (Start-328)
      • engineered mutation (318)
  • Heterogens: MTN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w8hA (A:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hA (A:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2w8hB (B:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hB (B:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2w8hC (C:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hC (C:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2w8hD (D:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hD (D:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >2w8hE (E:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hE (E:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >2w8hF (F:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hF (F:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >2w8hG (G:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hG (G:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >2w8hH (H:)
    gamvptiipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpql
    dnllksyeyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqv
    agktvsqvrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmd
    ainaagglaadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlk
    vfvmgevgkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiy
    qlnaqdasamvlgtefqlcpydivyvtta
    

    Sequence, based on observed residues (ATOM records):
    >2w8hH (H:)
    ipgqglnslrknvvelpdsdydldklvnvypmtpglidqlrpepviarsnpqldnllksy
    eyrigvgdvlmvtvwdhpelttpagqyrsasdtgnwvnsdgtifypyigkvqvagktvsq
    vrqditsrlttyiespqvdvsiaafrsqkvyvtgevansgkqaitnipltvmdainaagg
    laadadwrnvvlthngkdtkislyalmqkgdltqnhllyhgdilfipsnddlkvfvmgev
    gkqstlkmdrsgmtlaealgnaegisqemsdatgifvvrqlkgdrtgkiadiyqlnaqda
    samvlgtefqlcpydivyvtta