PDB entry 2w8b

View 2w8b on RCSB PDB site
Description: crystal structure of processed tolb in complex with pal
Class: protein transport/membrane protein
Keywords: protein transport membrane protein complex, tol, pal, tolb, membrane, palmitate, periplasm, bacteriocin transport, transport protein/lipoprotein, cell outer membrane, transport, lipoprotein, cell membrane, outer membrane
Deposited on 2009-01-15, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A855 (0-408)
      • conflict (368)
    Domains in SCOPe 2.07: d2w8ba1, d2w8ba2
  • Chain 'B':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w8bb1, d2w8bb2
  • Chain 'C':
    Compound: peptidoglycan-associated lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8B
    • Uniprot P0A912 (Start-109)
    Domains in SCOPe 2.07: d2w8bc_
  • Chain 'D':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w8bd1, d2w8bd2
  • Chain 'E':
    Compound: peptidoglycan-associated lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8B (110-End)
    • Uniprot P0A912 (Start-109)
    Domains in SCOPe 2.07: d2w8be1, d2w8be2
  • Chain 'F':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w8bf1, d2w8bf2
  • Chain 'G':
    Compound: peptidoglycan-associated lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8B (110-End)
    • Uniprot P0A912 (Start-109)
    Domains in SCOPe 2.07: d2w8bg1, d2w8bg2
  • Chain 'H':
    Compound: peptidoglycan-associated lipoprotein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W8B (110-End)
    • Uniprot P0A912 (Start-109)
    Domains in SCOPe 2.07: d2w8bh1, d2w8bh2
  • Heterogens: SO4, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w8bA (A:)
    evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
    saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
    ryaghtasdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqp
    lmspawspdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafa
    lsktgslnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvning
    gapqritwegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetps
    lapngtmvlysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w8bB (B:)
    evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
    saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
    ryaghtasdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqp
    lmspawspdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafa
    lsktgslnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvning
    gapqritwegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetps
    lapngtmviysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w8bC (C:)
    mlqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislge
    rranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8bC (C:)
    nnivyfdldkydirsdfaqmldahanflrssykvtveghadergtpeynislgerranav
    kmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w8bD (D:)
    evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
    saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
    ryaghtasdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqp
    lmspawspdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafa
    lsktgslnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvning
    gapqritwegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetps
    lapngtmviysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2w8bE (E:)
    mlqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislge
    rranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8bE (E:)
    nnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerran
    avkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w8bF (F:)
    evrividsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpg
    saqevqpaawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwl
    ryaghtasdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqp
    lmspawspdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafa
    lsktgslnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvning
    gapqritwegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetps
    lapngtmviysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2w8bG (G:)
    mlqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislge
    rranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8bG (G:)
    qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
    navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2w8bH (H:)
    mlqqnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislge
    rranavkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w8bH (H:)
    qnnivyfdldkydirsdfaqmldahanflrsnpsykvtveghadergtpeynislgerra
    navkmylqgkgvsadqisivsygkekpavlghdeaaysknrravlvyl