PDB entry 2w86

View 2w86 on RCSB PDB site
Description: crystal structure of fibrillin-1 domains cbegf9hyb2cbegf10, calcium saturated form
Deposited on 2009-01-09, released 2009-05-26
The last revision was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1872
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W86 (0-1)
    • Uniprot P35555 (2-146)
  • Heterogens: CA, IOD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w86A (A:)
    sadidecesspcingvcknspgsficecssestldptkticietikgtcwqtvidgrcei
    ningatlksqccsslgaawgspctlcqvdpicgkgysrikgtqcedidecevfpgvckng
    lcvntrgsfkcqcpsgmtldatgricl