PDB entry 2w85

View 2w85 on RCSB PDB site
Description: Structure of Pex14 in complex with Pex19
Deposited on 2009-01-09, released 2009-02-17
The last revision was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal membrane anchor protein pex14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: peroxin-19
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w85A (A:)
gamatpgsenvlprepliatavkflqnsrvrqsplatrraflkkkgltdeeidmafqqsg
taadepsslw

    Sequence, based on observed residues (ATOM records):
    >2w85A (A:)
envlprepliatavkflqnsrvrqsplatrraflkkkgltdeeidmafqqsgtaade

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2w85B (B:)
sqekffqelfds