PDB entry 2w7s

View 2w7s on RCSB PDB site
Description: spla serine protease of staphylococcus aureus (1.8a)
Class: hydrolase
Keywords: hydrolase, family s1
Deposited on 2008-12-30, released 2010-03-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease spla
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2w7sa_
  • Chain 'B':
    Compound: serine protease spla
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2w7sb_
  • Chain 'C':
    Compound: serine protease spla
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2w7sc_
  • Chain 'D':
    Compound: serine protease spla
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2w7sd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w7sA (A:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
    gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
    gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
    nfgvyftpqlkefiqnniek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7sA (A:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
    gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
    gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsseknfgv
    yftpqlkefiqnniek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w7sB (B:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
    gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
    gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
    nfgvyftpqlkefiqnniek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7sB (B:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgg
    gnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkga
    qtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsdeseknfgv
    yftpqlkefiqnnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w7sC (C:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
    gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
    gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
    nfgvyftpqlkefiqnniek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7sC (C:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaknrvsahhsskgggnydvk
    diveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkgaqtkykm
    festgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdeseknfgvyftp
    qlkefiqnniek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w7sD (D:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
    gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
    gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
    nfgvyftpqlkefiqnniek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w7sD (D:)
    eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiandifknrvsahhsgggnyd
    vkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkgaqtky
    kmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdeseknfgvyf
    tpqlkefiqnniek