PDB entry 2w7n

View 2w7n on RCSB PDB site
Description: crystal structure of kora bound to operator dna: insight into repressor cooperation in rp4 gene regulation
Deposited on 2008-12-23, released 2009-02-17
The last revision was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trfb transcriptional repressor protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: trfb transcriptional repressor protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 5'-d(*ap*ap*tp*gp*tp*tp*tp*ap*gp*cp *tp*ap*ap*ap*cp*ap*ap*g)-3'
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'F':
    Compound: 5'-d(*cp*brup*brup*gp*tp*tp*tp*ap*gp*cp*tp*ap *ap*ap*cp*ap*brup*t)-3'
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'G':
    Compound: 5'-d(*ap*ap*tp*gp*tp*tp*tp*ap*gp*cp *tp*ap*ap*ap*cp*ap*ap*g)-3'
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'H':
    Compound: 5'-d(*cp*brup*brup*gp*tp*tp*tp*ap*gp*cp*tp*ap *ap*ap*cp*ap*brup*t)-3'
    Species: Escherichia coli, synthetic [TaxId:562]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w7nA (A:)
mkkrltesqfqeaiqglevgqqtieiargvlvdgkpqatfatslgltrgavsqavhrvwa
afedknlpegyarvtavlpehqayivrkweadakkkqetkr

    Sequence, based on observed residues (ATOM records):
    >2w7nA (A:)
kkrltesqfqeaiqglevgqqtieiargvlvdgkpqatfatslgltrgavsqavhrvwaa
fedknlpegyarvtavlpehqayivrkweadakk

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2w7nB (B:)
mkkrltesqfqeaiqglevgqqtieiargvlvdgkpqatfatslgltrgavsqavhrvwa
afedknlpegyarvtavlpehqayivrkweadakkkqetkr

    Sequence, based on observed residues (ATOM records):
    >2w7nB (B:)
krltesqfqeaiqglevgqqtieiargvlvdgkpqatfatslgltrgavsqavhrvwaaf
edknlpegyarvtavlpehqayivrkweadakkkq

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.