PDB entry 2w7f

View 2w7f on RCSB PDB site
Description: crystal structure of y51fbsshmt l-ser external aldimine
Class: transferase
Keywords: one-carbon metabolism, plp-dependent enzymes, transferase
Deposited on 2008-12-22, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIB6 (0-404)
      • engineered mutation (50)
    Domains in SCOPe 2.07: d2w7fa_
  • Heterogens: SER, PLP, MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w7fA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkfaegypgrry
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd