PDB entry 2w7a

View 2w7a on RCSB PDB site
Description: structure of the human line-1 orf1p central domain
Deposited on 2008-12-22, released 2009-01-27
The last revision was dated 2009-01-27, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: line-1 orf1p
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W7A (0-3)
    • Uniprot Q15605 (4-99)
  • Chain 'B':
    Compound: line-1 orf1p
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W7A (Start-3)
    • Uniprot Q15605 (4-99)
  • Heterogens: MLI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w7aA (A:)
gamgnlrligvpesdvengtklentlqdiiqenfpnlarqanvqiqeiqrtpqryssrra
tprhiivrftkvemkekmlraarekgrvtlkgkpirltvd

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2w7aB (B:)
gamgnlrligvpesdvengtklentlqdiiqenfpnlarqanvqiqeiqrtpqryssrra
tprhiivrftkvemkekmlraarekgrvtlkgkpirltvd

    Sequence, based on observed residues (ATOM records):
    >2w7aB (B:)
amgnlrligvpesdvengtklentlqdiiqenfpnlarqanvqiqeiqrtpqryssrrat
prhiivrftkvemkekmlraarekgrvtlkgkpirltvd