PDB entry 2w72

View 2w72 on RCSB PDB site
Description: deoxygenated structure of a distal site hemoglobin mutant plus xe
Class: oxygen transport
Keywords: iron, heme, glycation, transport, phosphoprotein, packing defects, disease mutation, distal site point mutation, oxygen transport, hydrophobic cavities, glycoprotein, metal-binding
Deposited on 2008-12-19, released 2009-04-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.13
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human hemoglobin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered mutation (28)
      • engineered mutation (57)
  • Chain 'B':
    Compound: human hemoglobin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • conflict (0)
      • engineered mutation (27)
      • engineered mutation (62)
    Domains in SCOPe 2.02: d2w72b_
  • Chain 'C':
    Compound: human hemoglobin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • conflict (0)
      • engineered mutation (28)
      • engineered mutation (57)
    Domains in SCOPe 2.02: d2w72c_
  • Chain 'D':
    Compound: human hemoglobin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • conflict (0)
      • engineered mutation (27)
      • engineered mutation (62)
    Domains in SCOPe 2.02: d2w72d_
  • Heterogens: HEM, SO4, XE, K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w72B (B:)
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w72C (C:)
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w72D (D:)
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh